Lineage for d1kgib_ (1kgi B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2768958Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2768959Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2769679Species Norway rat (Rattus norvegicus) [TaxId:10116] [49476] (4 PDB entries)
  8. 2769681Domain d1kgib_: 1kgi B: [77389]
    complexed with t4a

Details for d1kgib_

PDB Entry: 1kgi (more details), 1.8 Å

PDB Description: rat transthyretin (also called prealbumin) complex with 3,3',5,5'- tetraiodothyroacetic acid (t4ac)
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d1kgib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgib_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn

SCOPe Domain Coordinates for d1kgib_:

Click to download the PDB-style file with coordinates for d1kgib_.
(The format of our PDB-style files is described here.)

Timeline for d1kgib_: