Lineage for d1kgcd2 (1kgc D:118-206)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517073Protein T-cell antigen receptor [49125] (7 species)
  7. 1517074Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries)
  8. 1517076Domain d1kgcd2: 1kgc D:118-206 [77385]
    Other proteins in same PDB: d1kgcd1, d1kgce1
    LC13 clone

Details for d1kgcd2

PDB Entry: 1kgc (more details), 1.5 Å

PDB Description: immune receptor
PDB Compounds: (D:) T-cell receptor alpha chain

SCOPe Domain Sequences for d1kgcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgcd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d1kgcd2:

Click to download the PDB-style file with coordinates for d1kgcd2.
(The format of our PDB-style files is described here.)

Timeline for d1kgcd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgcd1