Lineage for d1kgcd2 (1kgc D:118-206)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550341Protein T-cell antigen receptor [49125] (6 species)
  7. 550342Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (9 PDB entries)
  8. 550344Domain d1kgcd2: 1kgc D:118-206 [77385]
    Other proteins in same PDB: d1kgcd1, d1kgce1
    LC13 clone

Details for d1kgcd2

PDB Entry: 1kgc (more details), 1.5 Å

PDB Description: Immune Receptor

SCOP Domain Sequences for d1kgcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgcd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOP Domain Coordinates for d1kgcd2:

Click to download the PDB-style file with coordinates for d1kgcd2.
(The format of our PDB-style files is described here.)

Timeline for d1kgcd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgcd1