SCOPe 2.01: Domain d1kgcd1: 1kgc D:2-117

Lineage for d1kgcd1 (1kgc D:2-117)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries)

8. Domain d1kgcd1: 1kgc D:2-117 [77384]
   Other proteins in same PDB: d1kgcd2, d1kgce2
   LC13 clone

Details for d1kgcd1

PDB Entry: 1kgc, 1.5 Å

PDB Description: immune receptor

PDB Compounds: (D:) T-cell receptor alpha chain

SCOPe Domain Sequences for d1kgcd1:

Sequence; same for both SEQRES and ATOM records:

>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
kttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrmasl
aiaedrksstlilhratlrdaavyycilplaggtsygkltfgqgtiltvhpn

Timeline for d1kgcd1:

• d1kgcd1 first appeared in SCOP 1.63
  
• d1kgcd1 appears in SCOP 1.75
  
• d1kgcd1 appears in SCOPe 2.02
  
• d1kgcd1 appears in the current release, SCOPe 2.08