Lineage for d1kg6a_ (1kg6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2720988Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)
  6. 2720989Protein Catalytic domain of MutY [48155] (2 species)
  7. 2720996Species Escherichia coli [TaxId:562] [48156] (13 PDB entries)
    Uniprot P17802 1-225
  8. 2721003Domain d1kg6a_: 1kg6 A: [77382]
    complexed with gol, sf4, so4; mutant

Details for d1kg6a_

PDB Entry: 1kg6 (more details), 1.5 Å

PDB Description: crystal structure of the k142r mutant of e.coli muty (core fragment)
PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOPe Domain Sequences for d1kg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kg6a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvrrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkp

SCOPe Domain Coordinates for d1kg6a_:

Click to download the PDB-style file with coordinates for d1kg6a_.
(The format of our PDB-style files is described here.)

Timeline for d1kg6a_: