Lineage for d1kg5a_ (1kg5 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216178Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 216179Superfamily a.96.1: DNA-glycosylase [48150] (4 families) (S)
  5. 216184Family a.96.1.2: Mismatch glycosylase [48154] (2 proteins)
  6. 216185Protein Catalytic domain of MutY [48155] (1 species)
  7. 216186Species Escherichia coli [TaxId:562] [48156] (10 PDB entries)
  8. 216189Domain d1kg5a_: 1kg5 A: [77381]
    complexed with fs4, gol, so4; mutant

Details for d1kg5a_

PDB Entry: 1kg5 (more details), 1.35 Å

PDB Description: crystal structure of the k142q mutant of e.coli muty (core fragment)

SCOP Domain Sequences for d1kg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kg5a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli}
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvqrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk

SCOP Domain Coordinates for d1kg5a_:

Click to download the PDB-style file with coordinates for d1kg5a_.
(The format of our PDB-style files is described here.)

Timeline for d1kg5a_: