SCOPe 2.06: Domain d1kg4a_: 1kg4 A:

Lineage for d1kg4a_ (1kg4 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Escherichia coli [TaxId:562] [48156] (13 PDB entries)
   Uniprot P17802 1-225

8. Domain d1kg4a_: 1kg4 A: [77380]
   complexed with gol, sf4, so4; mutant

Details for d1kg4a_

PDB Entry: 1kg4, 1.6 Å

PDB Description: crystal structure of the k142a mutant of e. coli muty (core fragment)

PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOPe Domain Sequences for d1kg4a_:

Sequence; same for both SEQRES and ATOM records:

>d1kg4a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvarvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkp

Timeline for d1kg4a_:

• d1kg4a_ first appeared in SCOP 1.63
  
• d1kg4a_ appears in SCOPe 2.05
  
• d1kg4a_ appears in SCOPe 2.07
  
• d1kg4a_ appears in the current release, SCOPe 2.08