Lineage for d1kfwa2 (1kfw A:328-388)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 502014Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 502015Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 502117Protein Psychrophilic chitinase B [82626] (1 species)
  7. 502118Species Arthrobacter sp., tad20 [TaxId:1667] [82627] (1 PDB entry)
  8. 502119Domain d1kfwa2: 1kfw A:328-388 [77377]
    Other proteins in same PDB: d1kfwa1

Details for d1kfwa2

PDB Entry: 1kfw (more details), 1.74 Å

PDB Description: Structure of catalytic domain of psychrophilic chitinase B from Arthrobacter TAD20

SCOP Domain Sequences for d1kfwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20}
ygrgwtgaknvspwgpatdgapgtyetanedydklktlgtdhydaatgsawrydgtqwws
y

SCOP Domain Coordinates for d1kfwa2:

Click to download the PDB-style file with coordinates for d1kfwa2.
(The format of our PDB-style files is described here.)

Timeline for d1kfwa2:

502119
d1kfwa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1kfwa1