Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Psychrophilic chitinase B [82626] (1 species) |
Species Arthrobacter sp., tad20 [TaxId:1667] [82627] (1 PDB entry) |
Domain d1kfwa2: 1kfw A:328-388 [77377] Other proteins in same PDB: d1kfwa1 complexed with gol |
PDB Entry: 1kfw (more details), 1.74 Å
SCOP Domain Sequences for d1kfwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20} ygrgwtgaknvspwgpatdgapgtyetanedydklktlgtdhydaatgsawrydgtqwws y
Timeline for d1kfwa2: