Lineage for d1kfta_ (1kft A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272310Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 1272342Family a.60.2.3: Excinuclease UvrC C-terminal domain [81795] (1 protein)
  6. 1272343Protein Excinuclease UvrC C-terminal domain [81796] (1 species)
  7. 1272344Species Escherichia coli [TaxId:562] [81797] (1 PDB entry)
  8. 1272345Domain d1kfta_: 1kft A: [77375]

Details for d1kfta_

PDB Entry: 1kft (more details)

PDB Description: solution structure of the c-terminal domain of uvrc from e-coli
PDB Compounds: (A:) Excinuclease ABC subunit C

SCOPe Domain Sequences for d1kfta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]}
tssletiegvgpkrrqmllkymgglqglrnasveeiakvpgisqglaekifwslkh

SCOPe Domain Coordinates for d1kfta_:

Click to download the PDB-style file with coordinates for d1kfta_.
(The format of our PDB-style files is described here.)

Timeline for d1kfta_: