Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.3: Excinuclease UvrC C-terminal domain [81795] (1 protein) |
Protein Excinuclease UvrC C-terminal domain [81796] (1 species) |
Species Escherichia coli [TaxId:562] [81797] (1 PDB entry) |
Domain d1kfta_: 1kft A: [77375] |
PDB Entry: 1kft (more details)
SCOPe Domain Sequences for d1kfta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} tssletiegvgpkrrqmllkymgglqglrnasveeiakvpgisqglaekifwslkh
Timeline for d1kfta_: