SCOP 1.71: Domain d1kfeb_: 1kfe B:

Lineage for d1kfeb_ (1kfe B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (33 PDB entries)

8. Domain d1kfeb_: 1kfe B: [77374]
   Other proteins in same PDB: d1kfea_
   complexed with na, pls; mutant

Details for d1kfeb_

PDB Entry: 1kfe, 1.75 Å

PDB Description: crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with l-ser bound to the beta site

SCOP Domain Sequences for d1kfeb_:

Sequence; same for both SEQRES and ATOM records:

>d1kfeb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg

Timeline for d1kfeb_:

• d1kfeb_ first appeared in SCOP 1.63
  
• d1kfeb_ appears in SCOP 1.69
  
• d1kfeb_ appears in SCOP 1.73
  
• d1kfeb_ appears in the current release, SCOPe 2.08