Lineage for d1kfeb_ (1kfe B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 249795Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudodyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 249796Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 249797Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 249843Protein Tryptophan synthase, beta-subunit [53688] (1 species)
  7. 249844Species Salmonella typhimurium [TaxId:90371] [53689] (31 PDB entries)
  8. 249851Domain d1kfeb_: 1kfe B: [77374]
    Other proteins in same PDB: d1kfea_
    complexed with na, pls; mutant

Details for d1kfeb_

PDB Entry: 1kfe (more details), 1.75 Å

PDB Description: crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with l-ser bound to the beta site

SCOP Domain Sequences for d1kfeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfeb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg

SCOP Domain Coordinates for d1kfeb_:

Click to download the PDB-style file with coordinates for d1kfeb_.
(The format of our PDB-style files is described here.)

Timeline for d1kfeb_: