Lineage for d1kfcb_ (1kfc B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621089Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1621090Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1621091Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1621260Protein Tryptophan synthase, beta-subunit [53688] (3 species)
  7. 1621278Species Salmonella typhimurium [TaxId:90371] [53689] (38 PDB entries)
  8. 1621281Domain d1kfcb_: 1kfc B: [77372]
    Other proteins in same PDB: d1kfca_
    complexed with ipl, na, plp; mutant

Details for d1kfcb_

PDB Entry: 1kfc (more details), 1.5 Å

PDB Description: crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with indole propanol phosphate
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d1kfcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfcb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilka

SCOPe Domain Coordinates for d1kfcb_:

Click to download the PDB-style file with coordinates for d1kfcb_.
(The format of our PDB-style files is described here.)

Timeline for d1kfcb_: