SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1kfcb_ (1kfc B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139947Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2139970Species Salmonella typhimurium [TaxId:90371] [53689] (44 PDB entries)
  8. 2139973Domain d1kfcb_: 1kfc B: [77372]
    Other proteins in same PDB: d1kfca_
    complexed with ipl, na, plp; mutant

Details for d1kfcb_

PDB Entry: 1kfc (more details), 1.5 Å

PDB Description: crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with indole propanol phosphate
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d1kfcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfcb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilka

SCOPe Domain Coordinates for d1kfcb_:

Click to download the PDB-style file with coordinates for d1kfcb_.
(The format of our PDB-style files is described here.)

Timeline for d1kfcb_: