Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
Domain d1kfam2: 1kfa M:113-213 [77368] Other proteins in same PDB: d1kfah1, d1kfah2, d1kfai1, d1kfai2, d1kfal1, d1kfam1 part of anti-gibberellin A4 Fab 4-B8(8)/E9; conflict: annotated in PDB as human protein complexed with ga4 |
PDB Entry: 1kfa (more details), 2.8 Å
SCOP Domain Sequences for d1kfam2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfam2 b.1.1.2 (M:113-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radagptvssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhasytceaahktstspiaks
Timeline for d1kfam2: