Lineage for d1kfal1 (1kfa L:1-112)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782864Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity
    Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR
    Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1
    Uniprot P01642 21-115 #
    KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 782990Domain d1kfal1: 1kfa L:1-112 [77365]
    Other proteins in same PDB: d1kfah1, d1kfah2, d1kfai1, d1kfai2, d1kfal2, d1kfam2
    part of anti-gibberellin A4 Fab 4-B8(8)/E9; conflict: annotated in PDB as human protein

Details for d1kfal1

PDB Entry: 1kfa (more details), 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4
PDB Compounds: (L:) monoclonal antibody light chain

SCOP Domain Sequences for d1kfal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfal1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleik

SCOP Domain Coordinates for d1kfal1:

Click to download the PDB-style file with coordinates for d1kfal1.
(The format of our PDB-style files is described here.)

Timeline for d1kfal1: