Lineage for d1kfal1 (1kfa L:1-112)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363551Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (121 PDB entries)
  8. 363684Domain d1kfal1: 1kfa L:1-112 [77365]
    Other proteins in same PDB: d1kfah1, d1kfah2, d1kfai1, d1kfai2, d1kfal2, d1kfam2

Details for d1kfal1

PDB Entry: 1kfa (more details), 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4

SCOP Domain Sequences for d1kfal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfal1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleik

SCOP Domain Coordinates for d1kfal1:

Click to download the PDB-style file with coordinates for d1kfal1.
(The format of our PDB-style files is described here.)

Timeline for d1kfal1: