Lineage for d1kfai2 (1kfa I:127-225)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365428Domain d1kfai2: 1kfa I:127-225 [77364]
    Other proteins in same PDB: d1kfah1, d1kfai1, d1kfal1, d1kfal2, d1kfam1, d1kfam2
    part of anti-gibberellin A4 Fab 4-B8(8)/E9; conflict: annotated in PDB as human protein
    complexed with ga4

Details for d1kfai2

PDB Entry: 1kfa (more details), 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4

SCOP Domain Sequences for d1kfai2:

Sequence, based on SEQRES records: (download)

>d1kfai2 b.1.1.2 (I:127-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapxxxxxxxsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsssrpsetvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records): (download)

>d1kfai2 b.1.1.2 (I:127-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
tvpsssrpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1kfai2:

Click to download the PDB-style file with coordinates for d1kfai2.
(The format of our PDB-style files is described here.)

Timeline for d1kfai2: