SCOPe 2.08: Domain d1kfah1: 1kfa H:2-121

Lineage for d1kfah1 (1kfa H:2-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (15 PDB entries)
   Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity

8. Domain d1kfah1: 1kfa H:2-121 [77361]
   Other proteins in same PDB: d1kfah2, d1kfai2, d1kfal1, d1kfal2, d1kfam1, d1kfam2
   part of anti-gibberellin A4 Fab 4-B8(8)/E9; conflict: annotated in PDB as human protein
   complexed with ga4

Details for d1kfah1

PDB Entry: 1kfa, 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4

PDB Compounds: (H:) monoclonal antibody heavy chain

SCOPe Domain Sequences for d1kfah1:

Sequence; same for both SEQRES and ATOM records:

>d1kfah1 b.1.1.1 (H:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
vmlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfypd
svkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvss

Timeline for d1kfah1:

• d1kfah1 first appeared in SCOP 1.63
  
• d1kfah1 appears in SCOPe 2.07