Lineage for d1kf9f1 (1kf9 F:1533-1628)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761922Protein Growth hormone receptor [49280] (1 species)
  7. 2761923Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
    tandem of fibronectin type III domains
  8. 2761940Domain d1kf9f1: 1kf9 F:1533-1628 [77359]
    Other proteins in same PDB: d1kf9a_, d1kf9d_

Details for d1kf9f1

PDB Entry: 1kf9 (more details), 2.6 Å

PDB Description: phage display derived variant of human growth hormone complexed with two copies of the extracellular domain of its receptor
PDB Compounds: (F:) extracellular domain human growth hormone receptor (1-238)

SCOPe Domain Sequences for d1kf9f1:

Sequence, based on SEQRES records: (download)

>d1kf9f1 b.1.2.1 (F:1533-1628) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
pkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsagen
scyfnssftsiwipycikltsnggtvdekcfsvdei

Sequence, based on observed residues (ATOM records): (download)

>d1kf9f1 b.1.2.1 (F:1533-1628) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
pkftkcrsperetfschwtiqlfytrrqewkecpdyvsagenscyfnssftsiwipycik
ltsnggtvdekcfsvdei

SCOPe Domain Coordinates for d1kf9f1:

Click to download the PDB-style file with coordinates for d1kf9f1.
(The format of our PDB-style files is described here.)

Timeline for d1kf9f1: