Lineage for d1kf9e1 (1kf9 E:1233-1328)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290499Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 290500Family b.1.2.1: Fibronectin type III [49266] (20 proteins)
  6. 290611Protein Growth hormone receptor [49280] (1 species)
  7. 290612Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
    tandem of fibronectin type III domains
  8. 290629Domain d1kf9e1: 1kf9 E:1233-1328 [77357]
    Other proteins in same PDB: d1kf9a_, d1kf9d_

Details for d1kf9e1

PDB Entry: 1kf9 (more details), 2.6 Å

PDB Description: phage display derived variant of human growth hormone complexed with two copies of the extracellular domain of its receptor

SCOP Domain Sequences for d1kf9e1:

Sequence, based on SEQRES records: (download)

>d1kf9e1 b.1.2.1 (E:1233-1328) Growth hormone receptor {Human (Homo sapiens)}
pkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsagen
scyfnssftsiwipycikltsnggtvdekcfsvdei

Sequence, based on observed residues (ATOM records): (download)

>d1kf9e1 b.1.2.1 (E:1233-1328) Growth hormone receptor {Human (Homo sapiens)}
pkftkcrsperetfschwtlgpiqlfytrrntqewtqewkecpdyvsagenscyfnssft
siwipycikltsnggtvdekcfsvdei

SCOP Domain Coordinates for d1kf9e1:

Click to download the PDB-style file with coordinates for d1kf9e1.
(The format of our PDB-style files is described here.)

Timeline for d1kf9e1: