Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (18 proteins) |
Protein Growth hormone receptor [49280] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries) tandem of fibronectin type III domains |
Domain d1kf9c1: 1kf9 C:533-628 [77354] Other proteins in same PDB: d1kf9a_, d1kf9d_ |
PDB Entry: 1kf9 (more details), 2.6 Å
SCOP Domain Sequences for d1kf9c1:
Sequence, based on SEQRES records: (download)
>d1kf9c1 b.1.2.1 (C:533-628) Growth hormone receptor {Human (Homo sapiens)} pkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsagen scyfnssftsiwipycikltsnggtvdekcfsvdei
>d1kf9c1 b.1.2.1 (C:533-628) Growth hormone receptor {Human (Homo sapiens)} pkftkcrsperetfschwtiqlfytrrnewkecpdyvsagenscyfnssftsiwipycik lkcfsvdei
Timeline for d1kf9c1: