| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Anti-photoproduct Fab 64M-2, (mouse), kappa L chain [49113] (2 PDB entries) |
| Domain d1kegh2: 1keg H:114-228 [77346] Other proteins in same PDB: d1kegh1, d1kegl1 complexed with 64t, ni |
PDB Entry: 1keg (more details), 2.4 Å
SCOP Domain Sequences for d1kegh2:
Sequence, based on SEQRES records: (download)
>d1kegh2 b.1.1.2 (H:114-228) Immunoglobulin (constant domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
>d1kegh2 b.1.1.2 (H:114-228) Immunoglobulin (constant domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
akttapsvyplapvcgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1kegh2: