Lineage for d1kegh2 (1keg H:114-228)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221054Species Anti-photoproduct Fab 64M-2, (mouse), kappa L chain [49113] (2 PDB entries)
  8. 221055Domain d1kegh2: 1keg H:114-228 [77346]
    Other proteins in same PDB: d1kegh1, d1kegl1
    complexed with 64t, ni

Details for d1kegh2

PDB Entry: 1keg (more details), 2.4 Å

PDB Description: Antibody 64M-2 Fab complexed with dTT(6-4)TT
PDB Compounds: (H:)

SCOP Domain Sequences for d1kegh2:

Sequence, based on SEQRES records: (download)

>d1kegh2 b.1.1.2 (H:114-228) Immunoglobulin (constant domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1kegh2 b.1.1.2 (H:114-228) Immunoglobulin (constant domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
akttapsvyplapvcgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1kegh2:

Click to download the PDB-style file with coordinates for d1kegh2.
(The format of our PDB-style files is described here.)

Timeline for d1kegh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kegh1