SCOP 1.63: Domain d1kegh2: 1keg H:114-228

Lineage for d1kegh2 (1keg H:114-228)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-photoproduct Fab 64M-2, (mouse), kappa L chain [49113] (2 PDB entries)

8. Domain d1kegh2: 1keg H:114-228 [77346]
   Other proteins in same PDB: d1kegh1, d1kegl1
   complexed with 64t, ni

Details for d1kegh2

PDB Entry: 1keg, 2.4 Å

PDB Description: Antibody 64M-2 Fab complexed with dTT(6-4)TT

SCOP Domain Sequences for d1kegh2:

Sequence, based on SEQRES records:

>d1kegh2 b.1.1.2 (H:114-228) Immunoglobulin (constant domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records):

>d1kegh2 b.1.1.2 (H:114-228) Immunoglobulin (constant domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
akttapsvyplapvcgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1kegh2:

• d1kegh2 is new in SCOP 1.63
  
• d1kegh2 appears in SCOP 1.65
  
• d1kegh2 appears in the current release, SCOPe 2.08