SCOP 1.75: Domain d1kegh1: 1keg H:1-113

Lineage for d1kegh1 (1keg H:1-113)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E
   SQ NA # humanized antibody
   Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor
   Uniprot P01750 20-116 #
   HV06_MOUSE Ig heavy chain V region 102 precursor
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1kegh1: 1keg H:1-113 [77345]
   Other proteins in same PDB: d1kegh2, d1kegl1, d1kegl2
   part of anti-photoproduct Fab 64M-2
   complexed with 64t, ni

Details for d1kegh1

PDB Entry: 1keg, 2.4 Å

PDB Description: Antibody 64M-2 Fab complexed with dTT(6-4)TT

PDB Compounds: (H:) anti-(6-4) photoproduct antibody 64m-2 fab (heavy chain)

SCOP Domain Sequences for d1kegh1:

Sequence; same for both SEQRES and ATOM records:

>d1kegh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy
nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss

Timeline for d1kegh1:

• d1kegh1 first appeared in SCOP 1.63
  
• d1kegh1 appears in SCOP 1.73
  
• d1kegh1 appears in SCOPe 2.01
  
• d1kegh1 appears in the current release, SCOPe 2.08