SCOPe 2.08: Domain d1keba_: 1keb A:

Lineage for d1keba_ (1keb A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d1keba_: 1keb A: [77341]
   complexed with cu; mutant

Details for d1keba_

PDB Entry: 1keb, 1.8 Å

PDB Description: crystal structure of double mutant m37l,p40s e.coli thioredoxin

PDB Compounds: (A:) Thioredoxin 1

SCOPe Domain Sequences for d1keba_:

Sequence; same for both SEQRES and ATOM records:

>d1keba_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckliasildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d1keba_:

• d1keba_ first appeared in SCOP 1.63
  
• d1keba_ appears in SCOPe 2.07