Lineage for d1kdgb2 (1kdg B:513-693)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935246Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 2935268Protein Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain [82590] (1 species)
  7. 2935269Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [82591] (2 PDB entries)
  8. 2935271Domain d1kdgb2: 1kdg B:513-693 [77340]
    Other proteins in same PDB: d1kdga1, d1kdgb1
    complexed with 6fa, emt, hg, man, nag, unx

Details for d1kdgb2

PDB Entry: 1kdg (more details), 1.5 Å

PDB Description: crystal structure of the flavin domain of cellobiose dehydrogenase
PDB Compounds: (B:) cellobiose dehydrogenase

SCOPe Domain Sequences for d1kdgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdgb2 d.16.1.1 (B:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
naqdnpsinlvfthpsidayenwadvwsnprpadaaqylanqsgvfagaspklnfwrays
gsdgftryaqgtvrpgaasvnsslpynasqiftitvylstgiqsrgrigidaalrgtvlt
ppwlvnpvdktvllqalhdvvsnigsipgltmitpdvtqtleeyvdaydpatmnsnhwvs
s

SCOPe Domain Coordinates for d1kdgb2:

Click to download the PDB-style file with coordinates for d1kdgb2.
(The format of our PDB-style files is described here.)

Timeline for d1kdgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kdgb1