Lineage for d1kdgb1 (1kdg B:210-512,B:694-755)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096541Protein Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain [82309] (1 species)
  7. 2096542Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [82310] (2 PDB entries)
  8. 2096544Domain d1kdgb1: 1kdg B:210-512,B:694-755 [77339]
    Other proteins in same PDB: d1kdga2, d1kdgb2
    complexed with 6fa, emt, hg, man, nag, unx

Details for d1kdgb1

PDB Entry: 1kdg (more details), 1.5 Å

PDB Description: Crystal structure of the flavin domain of cellobiose dehydrogenase
PDB Compounds: (B:) cellobiose dehydrogenase

SCOPe Domain Sequences for d1kdgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdgb1 c.3.1.2 (B:210-512,B:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
ptvsatpydyiivgagpggiiaadrlseagkkvlllerggpstkqtggtyvapwatssgl
tkfdipglfeslftdsnpfwwckditvfagclvgggtsvngalywypndgdfsssvgwps
swtnhapytsklssrlpstdhpstdgqryleqsfnvvsqllkgqgynqatindnpnykdh
vfgysafdflngkragpvatylqtalarpnftfktnvmvsnvvrngsqilgvqtndptlg
pngfipvtpkgrvilsagafgtsrilfqsgigptdmiqtvqsnptaaaalppqnqwinlp
vgmXttigsspqsavvdsnvkvfgtnnlfivdagiiphlptgnpqgtlmsaaeqaaakil
alaggp

SCOPe Domain Coordinates for d1kdgb1:

Click to download the PDB-style file with coordinates for d1kdgb1.
(The format of our PDB-style files is described here.)

Timeline for d1kdgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kdgb2