Lineage for d1kdga2 (1kdg A:513-693)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404207Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1404208Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1404209Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 1404231Protein Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain [82590] (1 species)
  7. 1404232Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [82591] (2 PDB entries)
  8. 1404233Domain d1kdga2: 1kdg A:513-693 [77338]
    Other proteins in same PDB: d1kdga1, d1kdgb1
    complexed with 6fa, emt, hg, man, nag, unx

Details for d1kdga2

PDB Entry: 1kdg (more details), 1.5 Å

PDB Description: crystal structure of the flavin domain of cellobiose dehydrogenase
PDB Compounds: (A:) cellobiose dehydrogenase

SCOPe Domain Sequences for d1kdga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
naqdnpsinlvfthpsidayenwadvwsnprpadaaqylanqsgvfagaspklnfwrays
gsdgftryaqgtvrpgaasvnsslpynasqiftitvylstgiqsrgrigidaalrgtvlt
ppwlvnpvdktvllqalhdvvsnigsipgltmitpdvtqtleeyvdaydpatmnsnhwvs
s

SCOPe Domain Coordinates for d1kdga2:

Click to download the PDB-style file with coordinates for d1kdga2.
(The format of our PDB-style files is described here.)

Timeline for d1kdga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kdga1