SCOP 1.63: Domain d1kbyl_: 1kby L:

Lineage for d1kbyl_ (1kby L:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries)

8. Domain d1kbyl_: 1kby L: [77329]
   Other proteins in same PDB: d1kbyh1, d1kbyh2, d1kbym_
   complexed with bcl, bph, cdl, cl, fe, spo, u10; mutant

Details for d1kbyl_

PDB Entry: 1kby, 2.5 Å

PDB Description: structure of photosynthetic reaction center with bacteriochlorophyll- bacteriopheophytin heterodimer

SCOP Domain Sequences for d1kbyl_:

Sequence; same for both SEQRES and ATOM records:

>d1kbyl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1kbyl_:

• d1kbyl_ is new in SCOP 1.63
  
• d1kbyl_ appears in SCOP 1.65
  
• d1kbyl_ appears in the current release, SCOPe 2.08