SCOPe 2.03: Domain d1kbyh1: 1kby H:36-246

Lineage for d1kbyh1 (1kby H:36-246)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries)
   Uniprot P11846

8. Domain d1kbyh1: 1kby H:36-246 [77327]
   Other proteins in same PDB: d1kbyh2, d1kbyl_, d1kbym_
   complexed with bcl, bph, cdl, cl, fe, spo, u10

Details for d1kbyh1

PDB Entry: 1kby, 2.5 Å

PDB Description: structure of photosynthetic reaction center with bacteriochlorophyll- bacteriopheophytin heterodimer

PDB Compounds: (H:) Photosynthetic reaction center protein H chain

SCOPe Domain Sequences for d1kbyh1:

Sequence; same for both SEQRES and ATOM records:

>d1kbyh1 b.41.1.1 (H:36-246) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaap

Timeline for d1kbyh1:

• d1kbyh1 first appeared in SCOP 1.63
  
• d1kbyh1 appears in SCOPe 2.02
  
• d1kbyh1 appears in SCOPe 2.04
  
• d1kbyh1 appears in the current release, SCOPe 2.08