Lineage for d1kb9j_ (1kb9 J:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652873Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (36 PDB entries)
  8. 652888Domain d1kb9j_: 1kb9 J: [77325]
    Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9k_
    part of Fv against Rieske protein from the yeast cytochrome bc1 complex
    complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9j_

PDB Entry: 1kb9 (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex
PDB Compounds: (J:) heavy chain (vh) of fv-fragment

SCOP Domain Sequences for d1kb9j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb9j_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
ssawrhp

SCOP Domain Coordinates for d1kb9j_:

Click to download the PDB-style file with coordinates for d1kb9j_.
(The format of our PDB-style files is described here.)

Timeline for d1kb9j_: