Lineage for d1kb9i_ (1kb9 I:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958207Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 1958208Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1958209Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 1958210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (4 PDB entries)
  8. 1958211Domain d1kb9i_: 1kb9 I: [77324]
    Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9j_, d1kb9k_
    complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9i_

PDB Entry: 1kb9 (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex
PDB Compounds: (I:) ubiquinol-cytochrome c reductase complex 7.3 kd protein

SCOPe Domain Sequences for d1kb9i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb9i_ f.23.14.1 (I:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOPe Domain Coordinates for d1kb9i_:

Click to download the PDB-style file with coordinates for d1kb9i_.
(The format of our PDB-style files is described here.)

Timeline for d1kb9i_: