SCOPe 2.04: Domain d1kb9i_: 1kb9 I:

Lineage for d1kb9i_ (1kb9 I:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)
   automatically mapped to Pfam PF05365

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   interacts with cytochrome c1 and ISP

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (4 PDB entries)

8. Domain d1kb9i_: 1kb9 I: [77324]
   Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9j_, d1kb9k_
   complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9i_

PDB Entry: 1kb9, 2.3 Å

PDB Description: yeast cytochrome bc1 complex

PDB Compounds: (I:) ubiquinol-cytochrome c reductase complex 7.3 kd protein

SCOPe Domain Sequences for d1kb9i_:

Sequence; same for both SEQRES and ATOM records:

>d1kb9i_ f.23.14.1 (I:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

Timeline for d1kb9i_:

• d1kb9i_ first appeared in SCOP 1.63
  
• d1kb9i_ appears in SCOPe 2.03
  
• d1kb9i_ appears in SCOPe 2.05
  
• d1kb9i_ appears in the current release, SCOPe 2.08