SCOP 1.73: Domain d1kb9d2: 1kb9 D:261-307

Lineage for d1kb9d2 (1kb9 D:261-307)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81493] (5 PDB entries)

8. Domain d1kb9d2: 1kb9 D:261-307 [77318]
   Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_
   complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9d2

PDB Entry: 1kb9, 2.3 Å

PDB Description: yeast cytochrome bc1 complex

PDB Compounds: (D:) cytochrome c1, heme protein

SCOP Domain Sequences for d1kb9d2:

Sequence; same for both SEQRES and ATOM records:

>d1kb9d2 f.23.11.1 (D:261-307) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkp

Timeline for d1kb9d2:

• d1kb9d2 first appeared in SCOP 1.63
  
• d1kb9d2 appears in SCOP 1.71
  
• d1kb9d2 appears in SCOP 1.75
  
• d1kb9d2 appears in the current release, SCOPe 2.08