![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein) |
![]() | Protein Cytochrome bc1 domain [46677] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (5 PDB entries) |
![]() | Domain d1kb9d1: 1kb9 D:62-260 [77317] Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_ complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6 |
PDB Entry: 1kb9 (more details), 2.3 Å
SCOP Domain Sequences for d1kb9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb9d1 a.3.1.3 (D:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp attsqmakdvttflnwcae
Timeline for d1kb9d1: