Lineage for d1katv_ (1kat V:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638318Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2638330Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 2638333Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
    Uniprot P15692 40-133
  8. 2638382Domain d1katv_: 1kat V: [77309]
    complexed with a phage-derived peptide antagonist, chains X and Y

Details for d1katv_

PDB Entry: 1kat (more details)

PDB Description: solution structure of a phage-derived peptide antagonist in complex with vascular endothelial growth factor
PDB Compounds: (V:) vascular endothelial growth factor

SCOPe Domain Sequences for d1katv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1katv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
teesnitmqimrikphqgqhigemsflqhnkcecrpkkd

SCOPe Domain Coordinates for d1katv_:

Click to download the PDB-style file with coordinates for d1katv_.
(The format of our PDB-style files is described here.)

Timeline for d1katv_: