SCOPe 2.02: Domain d1katv_: 1kat V:

Lineage for d1katv_ (1kat V:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (17 PDB entries)
   Uniprot P15692 40-133

8. Domain d1katv_: 1kat V: [77309]
   complexed with a phage-derived peptide antagonist, chains X and Y

Details for d1katv_

PDB Entry: 1kat

PDB Description: solution structure of a phage-derived peptide antagonist in complex with vascular endothelial growth factor

PDB Compounds: (V:) vascular endothelial growth factor

SCOPe Domain Sequences for d1katv_:

Sequence; same for both SEQRES and ATOM records:

>d1katv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
teesnitmqimrikphqgqhigemsflqhnkcecrpkkd

Timeline for d1katv_:

• d1katv_ first appeared in SCOP 1.63
  
• d1katv_ appears in SCOPe 2.01
  
• d1katv_ appears in SCOPe 2.03
  
• d1katv_ appears in the current release, SCOPe 2.08