SCOP 1.65: Domain d1katv_: 1kat V:

Lineage for d1katv_ (1kat V:)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulphide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (11 PDB entries)

8. Domain d1katv_: 1kat V: [77309]

Details for d1katv_

PDB Entry: 1kat

PDB Description: solution structure of a phage-derived peptide antagonist in complex with vascular endothelial growth factor

SCOP Domain Sequences for d1katv_:

Sequence; same for both SEQRES and ATOM records:

>d1katv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
teesnitmqimrikphqgqhigemsflqhnkcecrpkkd

Timeline for d1katv_:

• d1katv_ first appeared in SCOP 1.63
  
• d1katv_ appears in SCOP 1.67
  
• d1katv_ appears in the current release, SCOPe 2.08