Lineage for d1ka9h_ (1ka9 H:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840330Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1840331Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1840406Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 1840429Species Thermus thermophilus [TaxId:274] [82350] (1 PDB entry)
  8. 1840430Domain d1ka9h_: 1ka9 H: [77308]
    Other proteins in same PDB: d1ka9f_

Details for d1ka9h_

PDB Entry: 1ka9 (more details), 2.3 Å

PDB Description: imidazole glycerol phosphate synthase
PDB Compounds: (H:) imidazole glycerol phosphtate synthase

SCOPe Domain Sequences for d1ka9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]}
mkallidygsgnlrsaakaleaagfsvavaqdpkaheeadllvlpgqghfgqvmrafqes
gfvervrrhlerglpflgicvgmqvlyegseeapgvrglglvpgevrrfragrvpqmgwn
alefggafapltgrhfyfansyygpltpyslgkgeyegtpftallakenllapqfhpeks
gkaglaflalarryf

SCOPe Domain Coordinates for d1ka9h_:

Click to download the PDB-style file with coordinates for d1ka9h_.
(The format of our PDB-style files is described here.)

Timeline for d1ka9h_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ka9f_