Lineage for d1ka9h_ (1ka9 H:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481897Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 481898Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (9 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 481968Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 481985Species Thermus thermophilus [TaxId:274] [82350] (1 PDB entry)
  8. 481986Domain d1ka9h_: 1ka9 H: [77308]
    Other proteins in same PDB: d1ka9f_

Details for d1ka9h_

PDB Entry: 1ka9 (more details), 2.3 Å

PDB Description: imidazole glycerol phosphate synthase

SCOP Domain Sequences for d1ka9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus}
mkallidygsgnlrsaakaleaagfsvavaqdpkaheeadllvlpgqghfgqvmrafqes
gfvervrrhlerglpflgicvgmqvlyegseeapgvrglglvpgevrrfragrvpqmgwn
alefggafapltgrhfyfansyygpltpyslgkgeyegtpftallakenllapqfhpeks
gkaglaflalarryf

SCOP Domain Coordinates for d1ka9h_:

Click to download the PDB-style file with coordinates for d1ka9h_.
(The format of our PDB-style files is described here.)

Timeline for d1ka9h_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ka9f_