SCOPe 2.04: Domain d1ka2a_: 1ka2 A:

Lineage for d1ka2a_ (1ka2 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
   combines M2, M3 and M32 families of metalloproteases
   the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain

6. Protein Thermostable carboxypeptidase 1 [82731] (1 species)
   M32 (Taq) family member; overall fold is similar to that of neurolysin but is less elaborated

7. Species Pyrococcus furiosus [TaxId:2261] [82732] (3 PDB entries)

8. Domain d1ka2a_: 1ka2 A: [77305]
   complexed with mg

Details for d1ka2a_

PDB Entry: 1ka2, 2.2 Å

PDB Description: Structure of Pyrococcus furiosus Carboxypeptidase Apo-Mg

PDB Compounds: (A:) M32 carboxypeptidase

SCOPe Domain Sequences for d1ka2a_:

Sequence; same for both SEQRES and ATOM records:

>d1ka2a_ d.92.1.5 (A:) Thermostable carboxypeptidase 1 {Pyrococcus furiosus [TaxId: 2261]}
evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
edmdaeyfvrwvkekyl

Timeline for d1ka2a_:

• d1ka2a_ first appeared in SCOP 1.63
  
• d1ka2a_ appears in SCOPe 2.03
  
• d1ka2a_ appears in SCOPe 2.05
  
• d1ka2a_ appears in the current release, SCOPe 2.08