Lineage for d1ka2a_ (1ka2 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867707Family d.92.1.5: Neurolysin-like [55505] (4 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 867733Protein Thermostable carboxypeptidase 1 [82731] (1 species)
    M32 (Taq) family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 867734Species Archaeon Pyrococcus furiosus [TaxId:2261] [82732] (3 PDB entries)
  8. 867739Domain d1ka2a_: 1ka2 A: [77305]
    complexed with mg

Details for d1ka2a_

PDB Entry: 1ka2 (more details), 2.2 Å

PDB Description: Structure of Pyrococcus furiosus Carboxypeptidase Apo-Mg
PDB Compounds: (A:) M32 carboxypeptidase

SCOP Domain Sequences for d1ka2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ka2a_ d.92.1.5 (A:) Thermostable carboxypeptidase 1 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
edmdaeyfvrwvkekyl

SCOP Domain Coordinates for d1ka2a_:

Click to download the PDB-style file with coordinates for d1ka2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ka2a_: