Lineage for d1k9xd_ (1k9x D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212133Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 1212170Protein Thermostable carboxypeptidase 1 [82731] (1 species)
    M32 (Taq) family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 1212171Species Pyrococcus furiosus [TaxId:2261] [82732] (3 PDB entries)
  8. 1212175Domain d1k9xd_: 1k9x D: [77304]

Details for d1k9xd_

PDB Entry: 1k9x (more details), 2.3 Å

PDB Description: Structure of Pyrococcus furiosus carboxypeptidase Apo-Yb
PDB Compounds: (D:) M32 carboxypeptidase

SCOPe Domain Sequences for d1k9xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9xd_ d.92.1.5 (D:) Thermostable carboxypeptidase 1 {Pyrococcus furiosus [TaxId: 2261]}
evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
edmdaeyfvrwvkekyl

SCOPe Domain Coordinates for d1k9xd_:

Click to download the PDB-style file with coordinates for d1k9xd_.
(The format of our PDB-style files is described here.)

Timeline for d1k9xd_: