Lineage for d1k9xd_ (1k9x D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729182Family d.92.1.5: Neurolysin-like [55505] (4 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 729208Protein Thermostable carboxypeptidase 1 [82731] (1 species)
    M32 (Taq) family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 729209Species Archaeon Pyrococcus furiosus [TaxId:2261] [82732] (3 PDB entries)
  8. 729213Domain d1k9xd_: 1k9x D: [77304]

Details for d1k9xd_

PDB Entry: 1k9x (more details), 2.3 Å

PDB Description: Structure of Pyrococcus furiosus carboxypeptidase Apo-Yb
PDB Compounds: (D:) M32 carboxypeptidase

SCOP Domain Sequences for d1k9xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9xd_ d.92.1.5 (D:) Thermostable carboxypeptidase 1 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
edmdaeyfvrwvkekyl

SCOP Domain Coordinates for d1k9xd_:

Click to download the PDB-style file with coordinates for d1k9xd_.
(The format of our PDB-style files is described here.)

Timeline for d1k9xd_: