Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) |
Family d.92.1.5: Neurolysin-like [55505] (3 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein Thermostable carboxypeptidase 1 [82731] (1 species) M32 (Taq) family member; overal fold is similar to that of neurolysin but is less elaborated |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [82732] (3 PDB entries) |
Domain d1k9xc_: 1k9x C: [77303] |
PDB Entry: 1k9x (more details), 2.3 Å
SCOP Domain Sequences for d1k9xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9xc_ d.92.1.5 (C:) Thermostable carboxypeptidase 1 {Archaeon Pyrococcus furiosus} evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig edmdaeyfvrwvkekyl
Timeline for d1k9xc_: