Lineage for d1k9xb_ (1k9x B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570477Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 2570540Protein Thermostable carboxypeptidase 1 [82731] (1 species)
    M32 (Taq) family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 2570541Species Pyrococcus furiosus [TaxId:2261] [82732] (3 PDB entries)
  8. 2570543Domain d1k9xb_: 1k9x B: [77302]

Details for d1k9xb_

PDB Entry: 1k9x (more details), 2.3 Å

PDB Description: Structure of Pyrococcus furiosus carboxypeptidase Apo-Yb
PDB Compounds: (B:) M32 carboxypeptidase

SCOPe Domain Sequences for d1k9xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9xb_ d.92.1.5 (B:) Thermostable carboxypeptidase 1 {Pyrococcus furiosus [TaxId: 2261]}
evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
edmdaeyfvrwvkekyl

SCOPe Domain Coordinates for d1k9xb_:

Click to download the PDB-style file with coordinates for d1k9xb_.
(The format of our PDB-style files is described here.)

Timeline for d1k9xb_: