Lineage for d1k9ta3 (1k9t A:444-516)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408694Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1408695Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1408738Protein Chitinase A [54558] (1 species)
  7. 1408739Species Serratia marcescens [TaxId:615] [54559] (11 PDB entries)
    Uniprot P07254 24-563
  8. 1408742Domain d1k9ta3: 1k9t A:444-516 [77300]
    Other proteins in same PDB: d1k9ta1, d1k9ta2
    complexed with nag

Details for d1k9ta3

PDB Entry: 1k9t (more details), 1.8 Å

PDB Description: Chitinase a complexed with tetra-N-acetylchitotriose
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1k9ta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ta3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
vfkpstgdlitfd

SCOPe Domain Coordinates for d1k9ta3:

Click to download the PDB-style file with coordinates for d1k9ta3.
(The format of our PDB-style files is described here.)

Timeline for d1k9ta3: