SCOP 1.69: Domain d1k9ta1: 1k9t A:24-132

Lineage for d1k9ta1 (1k9t A:24-132)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Chitinase A, N-terminal domain N [49233] (1 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Serratia marcescens [TaxId:615] [49234] (8 PDB entries)

8. Domain d1k9ta1: 1k9t A:24-132 [77298]
   Other proteins in same PDB: d1k9ta2, d1k9ta3

Details for d1k9ta1

PDB Entry: 1k9t, 1.8 Å

PDB Description: chitinase a complexed with tetra-n-acetylchitotriose

SCOP Domain Sequences for d1k9ta1:

Sequence; same for both SEQRES and ATOM records:

>d1k9ta1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

Timeline for d1k9ta1:

• d1k9ta1 first appeared in SCOP 1.63
  
• d1k9ta1 appears in SCOP 1.67
  
• d1k9ta1 appears in SCOP 1.71
  
• d1k9ta1 appears in the current release, SCOPe 2.08