Lineage for d1k9fa1 (1k9f A:143-679)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385375Family c.1.8.10: alpha-D-glucuronidase catalytic domain [82253] (1 protein)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 385376Protein alpha-D-glucuronidase catalytic domain [82254] (2 species)
    inverting reaction mechanism
  7. 385377Species Bacillus stearothermophilus [TaxId:1422] [82256] (7 PDB entries)
  8. 385381Domain d1k9fa1: 1k9f A:143-679 [77296]
    Other proteins in same PDB: d1k9fa2
    complexed with gcv, gol, xyp; mutant

Details for d1k9fa1

PDB Entry: 1k9f (more details), 1.75 Å

PDB Description: crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid

SCOP Domain Sequences for d1k9fa1:

Sequence, based on SEQRES records: (download)

>d1k9fa1 c.1.8.10 (A:143-679) alpha-D-glucuronidase catalytic domain {Bacillus stearothermophilus}
rlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikdyarllasvginaisinnvnv
hktetklitdhflpdvaevadifrtygiktflsinyaspieigglptadpldpevrrwwk
etakriyqyipdfggfvvkadsnfrpgpftygrdhaeganmlaealapfgglviwrcfvy
ncqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvrepvsplfgampktn
qmmevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvidgslfdyrysgiag
vsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtfgddsqvvetiswml
lsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadrdgigvdrtvatgtg
ytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqhiynthfegveqakql
rkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyrksgiddqygrkiyr

Sequence, based on observed residues (ATOM records): (download)

>d1k9fa1 c.1.8.10 (A:143-679) alpha-D-glucuronidase catalytic domain {Bacillus stearothermophilus}
rlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikdyarllasvginaisinnvnv
hktetklitdhflpdvaevadifrtygiktflsinyaspieigglptadpldpevrrwwk
etakriyqyipdfggfvvkapgpftygrdhaeganmlaealapfgglviwrcfvyncqqd
wrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvrepvsplfgampktnqmmev
qitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvidgslfdyrysgiagvsnig
sdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtfgddsqvvetiswmllsswr
iyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadrdgigvdrtvatgtgytaqy
fpenaamyesldtcpdelllffhhvpythrlhsgetviqhiynthfegveqakqlrkrwe
qlkgkidekryhdvlerltiqvehakewrdvintyfyrksgiddqygrkiyr

SCOP Domain Coordinates for d1k9fa1:

Click to download the PDB-style file with coordinates for d1k9fa1.
(The format of our PDB-style files is described here.)

Timeline for d1k9fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k9fa2