SCOP 1.71: Domain d1k9ea2: 1k9e A:4-142

Lineage for d1k9ea2 (1k9e A:4-142)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
   family GH67

6. Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
   inverting reaction mechanism

7. Species Bacillus stearothermophilus [TaxId:1422] [82740] (7 PDB entries)

8. Domain d1k9ea2: 1k9e A:4-142 [77295]
   Other proteins in same PDB: d1k9ea1
   complexed with gcv, gol; mutant

Details for d1k9ea2

PDB Entry: 1k9e, 1.85 Å

PDB Description: crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with 4-o-methyl- glucuronic acid

SCOP Domain Sequences for d1k9ea2:

Sequence; same for both SEQRES and ATOM records:

>d1k9ea2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus}
gyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevnet
ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr
llqmgeniaqlsiieqpkn

Timeline for d1k9ea2:

• d1k9ea2 first appeared in SCOP 1.63
  
• d1k9ea2 appears in SCOP 1.69
  
• d1k9ea2 appears in SCOP 1.73
  
• d1k9ea2 appears in the current release, SCOPe 2.08